PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09578.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 207aa    MW: 22161 Da    PI: 6.5158
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09578.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.91.5e-5825122198
                    NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                              vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plkvy
  mrna09578.1-v1.0-hybrid  25 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVY 110
                              69************************************************************************************ PP

                    NF-YB  87 lkkyrelegekk 98 
                              l+kyre+eg++k
  mrna09578.1-v1.0-hybrid 111 LAKYREMEGDTK 122
                              *********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.4E-5622139IPR009072Histone-fold
SuperFamilySSF471134.97E-4128135IPR009072Histone-fold
PfamPF008084.9E-283195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.8E-215977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.8E-217896No hitNo description
PRINTSPR006153.8E-2197115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MAEGPASPGG GGSHDSGEHS PRSNVREQDR YLPIANISRI MKKALPANGK IAKDAKETVQ  60
ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF EDYIDPLKVY LAKYREMEGD  120
TKGSGKGGDS SSKKEAQPSA IAQIPHQGSF SQGATYSNSQ TLGLLPSALG FDSLPLCTHL  180
LLLEFPASQM LWGQAGSLWI IGSKIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A4e-4826116494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B4e-4826116494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A5e-4826116393NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304397.11e-117PREDICTED: nuclear transcription factor Y subunit B-10-like
SwissprotQ67XJ21e-84NFYBA_ARATH; Nuclear transcription factor Y subunit B-10
TrEMBLA0A0R0KT721e-100A0A0R0KT72_SOYBN; Uncharacterized protein
TrEMBLV7CX891e-100V7CX89_PHAVU; Uncharacterized protein (Fragment)
TrEMBLV7CZA71e-100V7CZA7_PHAVU; Uncharacterized protein
STRINGGLYMA03G33490.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.11e-75nuclear factor Y, subunit B10